PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676791140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family YABBY
Protein Properties Length: 597aa    MW: 67490.4 Da    PI: 6.7704
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676791140genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY791.5e-24563462
      YABBY  4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaesh 62
                 ++eq+Cy+ CnfCn +lavsvP +slf++vtvrCGhCt+l svn+a a q l+ ++ 
  676791140  5 AMATEQLCYIPCNFCNIVLAVSVPCSSLFEIVTVRCGHCTNLWSVNMAAALQSLSRSNY 63
               6789********************************************99998876653 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.4E-25762IPR006780YABBY protein
CDDcd003036.91E-6156212No hitNo description
Gene3DG3DSA:3.10.10.101.1E-14318413No hitNo description
SuperFamilySSF566722.13E-58318597No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
MADSAMATEQ LCYIPCNFCN IVLAVSVPCS SLFEIVTVRC GHCTNLWSVN MAAALQSLSR  60
SNYQVPYPVP PKKSRRDLKE AKCREMLKDL KDKLPLADAV QMIPSLKRYM KGLVSRKVFE  120
EESVMLVSKE CSVVLQNKCQ PYAILIGKMT GLTNFKPTRI SLVFADRSTK VSIGVLEDLH  180
VQIGSTLIPA DVVVLELEDE PKDPLILGRS FLCTAGAIIN VREGIIDLQV GDIIARFEMK  240
KLLKKPMLYG QTFVVEDCFE IADEAAEENL ALDLLEADDE CEYEDGEYGG EYELGGRRVA  300
KRRTTCSTYL VIVKSELNNR RLNPNLKDVV KKEIIKILEA GVIYALSDSN WVSQFHVVPK  360
KGGFTVIKNE RNELIPTRTV TGHRMCVDYR KLNAATRKDH FPLPNIDQML ERLGFAVVGG  420
ETSRAELREM PLHGQRWDLL DHKISERGIE VDKEKIEVMM SLQPPTSVKG IHSFLGHAGF  480
YTRFIKDFSK IARPLIRLLC KETRFEFDSA CLEAFHTIKG ALVSTPVVQP AEWDLPFEVM  540
TDASDYDVGA VLGQQIEKKL HIIYYASHTL DEAQCRYATT EKKYLDFVFA FEKFKPY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ol8_A1e-11405595230415Reverse transcriptase/ribonuclease H
4ol8_B1e-11405595230415Reverse transcriptase/ribonuclease H
4ol8_E1e-11405595230415Reverse transcriptase/ribonuclease H
4ol8_F1e-11405595230415Reverse transcriptase/ribonuclease H
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1190912e-52AK119091.1 Arabidopsis thaliana At2g26580 mRNA for unknown protein, complete cds, clone: RAFL21-44-F19.
GenBankBT0037342e-52BT003734.1 Arabidopsis thaliana At2g26580 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013694887.11e-155PREDICTED: uncharacterized protein LOC106398934
TrEMBLA0A087GH161e-158A0A087GH16_ARAAL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.22e-37YABBY family protein